PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_010930409.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Arecales; Arecaceae; Arecoideae; Cocoseae; Elaeidinae; Elaeis
Family NAC
Protein Properties Length: 328aa    MW: 36908.8 Da    PI: 7.7782
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_010930409.1genomeOGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM170.36.1e-53111401129
             NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpk..kvka.eekewyfFskrdkkyatgkrknratksgyWkatgkdkev 92 
                     +ppGfrFhPtdeel+ +yLkkk++ +k+++ evi+e+d++kvePwdL++  ++ +  ++ewyfFs++d+ky+tg+r+nrat++g+Wkatg+dk +
  XP_010930409.1  11 VPPGFRFHPTDEELLLFYLKKKISFEKFDM-EVIREIDLNKVEPWDLQErcRIGStPQNEWYFFSHKDRKYPTGSRTNRATNAGFWKATGRDKCI 104
                     69****************************.99**************963433332556************************************ PP

             NAM  93 lskkgelvglkktLvfykgrapkgektdWvmheyrle 129
                      + + +++g++ktLvfy+grap+g+ktdW+mheyrle
  XP_010930409.1 105 RT-TYKKIGMRKTLVFYRGRAPHGQKTDWIMHEYRLE 140
                     *9.8999****************************85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.57E-617162IPR003441NAC domain
PROSITE profilePS5100558.23411162IPR003441NAC domain
PfamPF023652.2E-2712139IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009834Biological Processplant-type secondary cell wall biogenesis
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0048829Biological Processroot cap development
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 328 aa     Download sequence    Send to blast
MASSSSSNSG VPPGFRFHPT DEELLLFYLK KKISFEKFDM EVIREIDLNK VEPWDLQERC  60
RIGSTPQNEW YFFSHKDRKY PTGSRTNRAT NAGFWKATGR DKCIRTTYKK IGMRKTLVFY  120
RGRAPHGQKT DWIMHEYRLE DSDDANGSGA EDGWVVCRVF KKKCFLRXGT GGGTSQASEN  180
HMGGPASHDH QPRPLSSQYI HPHHGFHHHH HHHHHPVSNL YYSQLPPQSY SPVQVQDLLT  240
NHRPAGYDFS VLPTESSAMV KPYEGGLEVG ACEGMQQVGE GRDQSSNDWA VLDGIDGRFG  300
GAGGAAVQQM NQISGQPGGE MELWGYGK
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4dul_B5e-551116317166NAC domain-containing protein 19
4dul_A5e-551116317166NAC domain-containing protein 19
1ut7_B5e-551116317166NO APICAL MERISTEM PROTEIN
1ut7_A5e-551116317166NO APICAL MERISTEM PROTEIN
1ut4_B5e-551116317166NO APICAL MERISTEM PROTEIN
1ut4_A5e-551116317166NO APICAL MERISTEM PROTEIN
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00431DAPTransfer from AT4G10350Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010930409.10.0PREDICTED: LOW QUALITY PROTEIN: protein BEARSKIN1-like
SwissprotQ9SV871e-110BRN2_ARATH; Protein BEARSKIN2
TrEMBLM0S5F51e-152M0S5F5_MUSAM; Uncharacterized protein
STRINGGSMUA_Achr2P05640_0011e-152(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP92973046
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G10350.11e-108NAC domain containing protein 70